Protein Info for RS_RS10740 in Ralstonia solanacearum GMI1000

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 81 to 107 (27 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 272 (173 residues), 57.9 bits, see alignment E=5.9e-20

Best Hits

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 100% identity to rso:RSc2142)

MetaCyc: 66% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XXH2 at UniProt or InterPro

Protein Sequence (286 amino acids)

>RS_RS10740 carbohydrate ABC transporter permease (Ralstonia solanacearum GMI1000)
MSDGMLDMRRAGGPPNVFGAVRRALPGVLAWLIALALFFPIFWMAITAFKTEQQAYEASL
FFVPTLDSFREVFARSNYFAFAWNSVLISAGVTVICLALAVPAAYAMAFFPNRRTQKVLL
WMLSTKMMPSVGVLVPIYLLWKNAGLLDTVSGLVIVYALINLPIAVWMAFTYFNEIPKDI
LESGRIDGASTWQEIVYLLMPMALPGLASTALLLVILSWNEAFWSINLSSSNAAPLTVFI
ASYSSPEGLFWAKLSAASLLAVAPILVVGWLSQKQLVRGLTFGAVK