Protein Info for RS_RS09755 in Ralstonia solanacearum GMI1000

Annotation: phage major capsid protein, P2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR01551: phage major capsid protein, P2 family" amino acids 6 to 333 (328 residues), 354 bits, see alignment E=3.8e-110 PF05125: Phage_cap_P2" amino acids 9 to 332 (324 residues), 518.1 bits, see alignment E=4.6e-160

Best Hits

Swiss-Prot: 58% identical to CAPSD_BPP2: Capsid proteins (N) from Escherichia phage P2

KEGG orthology group: None (inferred from 100% identity to rso:RSc1937)

Predicted SEED Role

"Phage major capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XY26 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RS_RS09755 phage major capsid protein, P2 family (Ralstonia solanacearum GMI1000)
MRNETRRLFTAYKDAIAKLNGVARVDEKFSVAPSVQQKLETKVQESSDFLTRINFYGVPE
QEAEKIGLGVSGPVASNTDTTQQDRQTSDIATLDGRRYRCEQTNSDTHITYQRLDAWAKF
PDFQTRIRDAIIKRQALDRIMIGFNGVSRAATSNRVVNPMLQDVNKGWLQNLREQAPQRV
MEEGKKAAGKIIVGAGGDYGNLDALVFDVVNQLVEPWYAEDPELVVLCGRNLLADKYFPL
VNKDRDPVQQIAADLIISQKRIGNLQAVRVPYFPANGLLVTRLDNLSIYYQENARRRTIL
DNAKRDRIENYESSNDAYVIEDLACAAMAENIELAAAA