Protein Info for RS_RS06400 in Ralstonia solanacearum GMI1000

Annotation: cytochrome-c oxidase, cbb3-type subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to rso:RSc1277)

MetaCyc: 69% identical to cbb3-1 cytochrome c oxidase subunit O (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

aerobic respiration I (cytochrome c) (3/4 steps found)
arsenite to oxygen electron transfer (1/2 steps found)
NADPH to cytochrome c oxidase via plastocyanin (thylakoid membrane) (2/4 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XZW8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>RS_RS06400 cytochrome-c oxidase, cbb3-type subunit II (Ralstonia solanacearum GMI1000)
MSNQPSRFFSHETLEKNIGLLIIMTLVVVSIAGLVQIVPLFFQHSTTEPVKGIAPYSPLR
LAGRDIYIREGCVGCHSQQVRTLRAETERYGHYSMAGESVFDHPFLWGSKRTGPDLARVG
QRYSDDWHRIHLRDPRMVVPESNMPSYAWLSKTPLDNHDIEAKMRVLRKLGVPYTDAQIA
GAREQLAGKTEEDAVVAYLQGLGVELRNVRDVAGVPVAAAAKE