Protein Info for RS_RS05365 in Ralstonia solanacearum GMI1000

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 107 to 121 (15 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 313 (299 residues), 159.5 bits, see alignment E=5.5e-51 amino acids 306 to 417 (112 residues), 35 bits, see alignment E=3.9e-13

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to rso:RSc1080)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0G4 at UniProt or InterPro

Protein Sequence (432 amino acids)

>RS_RS05365 MFS transporter (Ralstonia solanacearum GMI1000)
MKTIKGLRWWIIALVCLGTITNYLARNSLGVLAPQLKTELGMSTQQYSYVVGAFQIGYTI
MQPVCGFIVDLIGLRIGFALFAVLWSIAGCLHAGASGWLSLASFRGLMGLTEAAAIPSGM
KAVAEWFPDKEKSVAVGYFNAGTSLGALLAPPLVVFLSLRYGWQSAFVVTGALGFVWAAL
WYGFYRSPREHAKLSATEHDRIIGGQIRSAGAARGKRPVREVVTSRRFWAIALPRFFAEP
AWQTFSFWIPLYLSSARHMDLKEIALFAWLPFLAADLGGLLGGYLSPFFMKFFRVPLIWS
RVCGVVLGAFLMIGPACIGLVASPYQAIALFCVGGFAHQMISTLVNTLSADVFDPEEVGT
ASGFAGMAAWIGGLGFSLMVGALADTVGYGPLFGLLGAFDLIGATLLILLIRGQSQEERA
ARQMQHHLSASH