Protein Info for RS_RS04585 in Ralstonia solanacearum GMI1000

Annotation: MetQ/NlpA family ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF10518: TAT_signal" amino acids 1 to 20 (20 residues), 24.6 bits, see alignment (E = 2.5e-09) TIGR00363: lipoprotein, YaeC family" amino acids 26 to 266 (241 residues), 260.7 bits, see alignment E=7.8e-82 PF03180: Lipoprotein_9" amino acids 31 to 266 (236 residues), 314.1 bits, see alignment E=7.2e-98 PF09084: NMT1" amino acids 53 to 151 (99 residues), 21.4 bits, see alignment E=3e-08

Best Hits

Swiss-Prot: 44% identical to METQ_VIBCH: Probable D-methionine-binding lipoprotein MetQ (metQ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 100% identity to rso:RSc0922)

MetaCyc: 52% identical to L-methionine/D-methionine ABC transporter membrane anchored binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0X1 at UniProt or InterPro

Protein Sequence (266 amino acids)

>RS_RS04585 MetQ/NlpA family ABC transporter substrate-binding protein (Ralstonia solanacearum GMI1000)
MNRRQLLQWSAGLGAALALAAGGALAQGKPIKIGVTAGPHAEIMEAVKKVAEQDGLKLQI
VEFNDYIQPNAALAAGDLDANSYQHQPYLDDQIATRGYKFVSVGQTITFPMGVYSKKIKS
LKDLKDGARFGLPNDPTNGGRALLLLQAQGVIKLKPNAGFKASPRDVAENPRKLKFVELD
AAQLPRSLDDLDAAAVNGNYAEKAGLDPTRDGIAIESPKGPYANVIAVRAADKDQPWVAK
LVKAYHSDAVKAFVKTKYKDAVIVAW