Protein Info for RS_RS02545 in Ralstonia solanacearum GMI1000

Annotation: nucleotidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00483: NTP_transferase" amino acids 2 to 131 (130 residues), 82 bits, see alignment E=5.4e-27 PF12804: NTP_transf_3" amino acids 3 to 114 (112 residues), 45.3 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 51% identical to MURU_PSEPK: N-acetylmuramate alpha-1-phosphate uridylyltransferase (murU) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00992, [EC: 2.7.7.-] (inferred from 100% identity to rso:RSc0511)

MetaCyc: 51% identical to N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase (Pseudomonas putida KT2440)
RXN-18661 [EC: 2.7.7.99]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.99

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y225 at UniProt or InterPro

Protein Sequence (241 amino acids)

>RS_RS02545 nucleotidyltransferase family protein (Ralstonia solanacearum GMI1000)
MKAMIFAAGRGDRMRPLTDRTPKPLLPVGGKPLIVWQIERLAAAGVRDIVINHAWLGAQI
EAALGDGGAWGVRLAYSPESEALETAGGVVQALPLLHTGDAHSVFIAVSGDVFCDYDYAA
LREHAQALAARPAPGMHLVMVPNPPYHPRGDFALAADGRLYGDDAPAGIPRLTFGNIGLY
DTRLFDGIAPGTRLAMTPLYRRAIAAGQATGERFDGPWENVGTPAQLAALDAALSAPSRS
A