Protein Info for RS_RS01345 in Ralstonia solanacearum GMI1000

Annotation: butyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 4 to 116 (113 residues), 134.7 bits, E=3.8e-43
• PF02770: Acyl-CoA_dh_M
  • amino acids 120 to 215 (96 residues), 94.9 bits, E=5.2e-31
• PF00441: Acyl-CoA_dh_1
  • amino acids 227 to 375 (149 residues), 176.1 bits, E=1e-55
• PF08028: Acyl-CoA_dh_2
  • amino acids 242 to 364 (123 residues), 102.3 bits, E=5e-33

Best Hits

Swiss-Prot: 46% identical to ACADS_RAT: Short-chain specific acyl-CoA dehydrogenase, mitochondrial (Acads) from Rattus norvegicus

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to rso:RSc0274)

MetaCyc: 63% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
• β-alanine biosynthesis II (5/6 steps found)
• valproate β-oxidation (6/9 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.1, 1.3.99.-

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.-

Sequence Analysis Tools

See Q8Y2R1 at UniProt or InterPro

Protein Sequence (376 amino acids)

>RS_RS01345 butyryl-CoA dehydrogenase (Ralstonia solanacearum GMI1000)
MLLTPEQEMIRDAIRTFVREAIVPHAAAWDRDATFPKDVHRQLGELGAYGVAVPEAYGGA
GLDYLSLALILEEIAAGDGGTSTVISVNNCPVCSMLMAYADEAQKQRWLAPLARGEMLGA
FCLTEPHVGSDAAALRTTATRDGEHWVLNGVKQFITSGKHADVAIVMAVTDKAAGKRGIS
AFLVPTATPGYIVARLEDKLGQHSSDTAQIVLEDCRIPADCLLGSAGEGYRMALSGLEGG
RIGIAAQSVGMARAAFEAALAYAKERESFGQPLFAHQAVQFRLAEMATRIDVARQMVWHA
ASLKDAGRACLKEAAMAKLNASEMAERVCSDAIQVFGGYGYVSDFPVERIYRDVRVCQIY
EGTSDIQKILIARALA