Protein Info for RS_RS00160 in Ralstonia solanacearum GMI1000

Annotation: pyrimidine 5'-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR01993: pyrimidine 5'-nucleotidase" amino acids 31 to 214 (184 residues), 146.3 bits, see alignment E=8.5e-47 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 32 to 215 (184 residues), 57 bits, see alignment E=2.5e-19 PF00702: Hydrolase" amino acids 33 to 199 (167 residues), 43.6 bits, see alignment E=4.7e-15 PF13419: HAD_2" amino acids 33 to 215 (183 residues), 30 bits, see alignment E=5.6e-11

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to rso:RSc0032)

Predicted SEED Role

"Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type" (EC 3.1.3.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y3E8 at UniProt or InterPro

Protein Sequence (287 amino acids)

>RS_RS00160 pyrimidine 5'-nucleotidase (Ralstonia solanacearum GMI1000)
MRTARAPRARHAGRAWPREVAAPGLPRRQPVWLFDLDNTLHHASHAIFPQINRLMTAYVA
RVLGTDEATASRVRVDYWRRYGATILGMVRHHGVDPDDFLAQAHRFDDLRAMVRAERGLA
QLLRALPGRKILLTNAPAAYAREVVRHIGLRRAFAREIAVEHMWVHRRLRPKPDPLMLRR
LLARERIAPSRAILVEDTLSHLKRYRRLGLSTVWVTGYLRRVAPGVVPAAAADALHPMQA
AALGARANSPQRQPAAPILFANRPGYVSVKVKSVLQLQRRLVRHGRG