Protein Info for RR42_RS37480 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 34 to 293 (260 residues), 90.9 bits, see alignment E=6.1e-30 PF03631: Virul_fac_BrkB" amino acids 40 to 296 (257 residues), 169.4 bits, see alignment E=6.1e-54

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 83% identity to reh:H16_B2572)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRF8 at UniProt or InterPro

Protein Sequence (321 amino acids)

>RR42_RS37480 membrane protein (Cupriavidus basilensis FW507-4G11)
MDRAPPKQRARGIGHWLPDRHTATRTASVVLAAVSAWLAHRAASKGAALSFYMLFSLAPV
LVLVISIAGVFFGAQAARGEIFAQIDDLVGAQGAAAIQEILAATHRSGGGGLAAAIATGI
LFVGATSVFAELKGSLDEIWETPAPQGAGWQQLLRARLLSFSLVLVLAFMLLVSLIVNAA
LAVVDRFWGQMWTQSWFAPVADALSTAFSFGVVTLLFAVIFKMLPNARIAWRDVVMGAII
TALLFAVGKRLIGLYLGHSAVASSYGAAGSVVALMLWVYYSAQIFFFGAELTRQYALQFG
SLRGQSTNPPPDPRAAGPANR