Protein Info for RR42_RS37315 in Cupriavidus basilensis FW507-4G11

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details PF00672: HAMP" amino acids 297 to 346 (50 residues), 24.3 bits, see alignment 4.7e-09 TIGR00229: PAS domain S-box protein" amino acids 357 to 474 (118 residues), 32.6 bits, see alignment E=7.8e-12 PF08448: PAS_4" amino acids 366 to 472 (107 residues), 58.4 bits, see alignment E=1.2e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 480 to 642 (163 residues), 127.4 bits, see alignment E=4.5e-41 PF00990: GGDEF" amino acids 484 to 638 (155 residues), 143.4 bits, see alignment E=8.1e-46

Best Hits

KEGG orthology group: None (inferred from 68% identity to reh:H16_B0107)

Predicted SEED Role

"FIG00973914: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGN7 at UniProt or InterPro

Protein Sequence (650 amino acids)

>RR42_RS37315 diguanylate cyclase (Cupriavidus basilensis FW507-4G11)
MPQVSLSLKARLALITTALAAVLGTGIVLASLYYAHDDLRAALQDQQDSIVKLASDQLDT
AMEDRVTLLSHVAPQLAGELSRPGAELRLLLERRIPVPGAFNAFMLADAQGRVLARDGVQ
VSIADRDYFREAARTLEPVITPPIRARINGATGVLVAVPIVSKQGEFLGVLGGWLDLSSA
NFLVEITHNRLGTTGFYCLVSGGRMPVYVRHPDPAKATQPARALGDTCGVDDHSGRVEFL
SPARPLISRYLMESTGWELVAVLPAQEAFAPLHAMQVRFLALALLSLAVVALLIWLTVRH
LLTPLTRLHQVVSDSARDLAAYEKLPAQQRDEIGDLARAFGQLMRDVRERREQLDLSERQ
LRAVTDTLPALLAFIGPDERYVFNNLAYERTFGITVQALRGMTVREVIGDTRYARARPFL
QKALAGSAVTFETEENDPDYRCMETSLRPEWSADGSHVVGVHVHVQDVTQRKLETLRLSR
ISRLDHLTQLLNRNAFEALLQAAMARSREDGRLMALLYLDMDRFKAVNDFHGHITGDLLL
QAFGRRLQRCVRERDTVARLGGDEFAVVLEDIGGAANAQRIAQAIVHSVSRRFFIDGVFA
DVDVSIGVALYKGAPMPDQELMRQADALLYRAKAAGRGRFEMGPPELLDS