Protein Info for RR42_RS37295 in Cupriavidus basilensis FW507-4G11

Annotation: phosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 8 to 337 (330 residues), 561.4 bits, see alignment E=3.1e-173 PF13531: SBP_bac_11" amino acids 27 to 285 (259 residues), 60.8 bits, see alignment E=3.5e-20 PF01547: SBP_bac_1" amino acids 35 to 279 (245 residues), 71.3 bits, see alignment E=3e-23 PF13416: SBP_bac_8" amino acids 41 to 282 (242 residues), 68 bits, see alignment E=2.4e-22 PF13343: SBP_bac_6" amino acids 93 to 306 (214 residues), 85 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 93% identity to reu:Reut_B5525)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGN3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>RR42_RS37295 phosphonate ABC transporter substrate-binding protein (Cupriavidus basilensis FW507-4G11)
MTHLFRTATAVAAFALLAGAAHANTVLTVYTALEADQIAAYKAAFEKANPDIEIKWVRDS
TGIVTAKLLAEKAAPRADAVWGLAGSSLAILDKEGMLQPYAPKNLAAVDAQYRSAANPPA
WVGMDVWGAAICFNTIEAQKQGLPKPTSWADLTKPVYAGKIVMPHPASSGTGYLDVSAWL
QMMGEQKGWSYMDALHKNIGLYTHSGSKPCKMAAQGEFPIGIAFEYRAMKSKKEGAPIDI
VLPSEGLGWDIEATAIIKGTKNPDAARKLADFSASSDAMALYEKNFAVLAIPGIAKPDPL
LPADYEKRLIKNDFTWASANRDRILAEWSKRYEGKAEKK