Protein Info for RR42_RS36490 in Cupriavidus basilensis FW507-4G11

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02771: Acyl-CoA_dh_N" amino acids 19 to 129 (111 residues), 117.6 bits, see alignment E=7.7e-38 PF02770: Acyl-CoA_dh_M" amino acids 134 to 234 (101 residues), 88.2 bits, see alignment E=6.8e-29 PF00441: Acyl-CoA_dh_1" amino acids 247 to 394 (148 residues), 151.7 bits, see alignment E=3.6e-48 PF08028: Acyl-CoA_dh_2" amino acids 265 to 383 (119 residues), 43 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 47% identical to ACADL_PIG: Long-chain specific acyl-CoA dehydrogenase, mitochondrial (ACADL) from Sus scrofa

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 85% identity to reu:Reut_B3552)

MetaCyc: 47% identical to (4S)-homoplatensicyl-CoA dehydrogenase (Streptomyces platensis)
1.3.8.-

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2, 1.3.99.3

Use Curated BLAST to search for 1.3.99.2 or 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPA3 at UniProt or InterPro

Protein Sequence (395 amino acids)

>RR42_RS36490 acyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MGNSDKNMAMAARRVSWMSEDLVMFQDTVRRFVERELVPNEARWAERGYIDREVWNRAGE
VGLLCASIPEEYGGGGGNFAHEAVICNEMARAIATSLGNGVHSGIVAHYLLNYGIEAQKR
NWLPQMASGAMVAAIAMSEPGAGSDLKSVRTRAVREKTQNGDIYRINGAKTFITNGYHAD
LVCVVAKTDPDAGTKGVSLIMVETRDQPGFRRGRILEKIGQKGQDTAELFFDDVCVPVEN
LLGDEEGKGFYQLMQQLPQERMIIALGAVASMQRAIELTTDYVRERQVFGKPLIDMQNTR
FKLAECKTEATIAATFVDDCMVRLLKGELDAPTAAMAKWWCSQKNCEIIDECLQLHGGYG
YMLEYPIARMYANARVSKIYGGSNEIMKELVARTL