Protein Info for RR42_RS36460 in Cupriavidus basilensis FW507-4G11

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 86 to 101 (16 residues), see Phobius details amino acids 112 to 127 (16 residues), see Phobius details PF00441: Acyl-CoA_dh_1" amino acids 181 to 312 (132 residues), 71.1 bits, see alignment E=1.2e-23 PF08028: Acyl-CoA_dh_2" amino acids 182 to 296 (115 residues), 26.3 bits, see alignment E=7.6e-10

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 69% identity to reh:H16_B0703)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2, 1.3.99.3

Use Curated BLAST to search for 1.3.99.2 or 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG83 at UniProt or InterPro

Protein Sequence (333 amino acids)

>RR42_RS36460 acyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MHNAYSDALDSVLRDCCTPAVIRAIERGEDHLPLWQSLQDSGFADCLLPEAAGGAGLPLD
ELAPVLFALGRRALPLPLGQTLFARALLHAAGLAVPAGPIALATFDMEAGAANAVLVAGG
AQAAWFLVQEGTQCMLLPRDRAQVRATGAHADLAVVLPRPASDGLPLFTLPAGTLRQIGA
CLHAAQLAGAMSHVLDMTLQYANDRQQFGRAIGKFQAIQHQISVMAEHVTAARMAAQIAC
AAGGWLPNPLRAAIGKLNASEAVTPVAAIAHAVHGAIGITEEYDLQIYTRRLHAWQLADG
SQAYWARVVGEAVCGQPGTGVVDLTRSWSTDAA