Protein Info for RR42_RS36295 in Cupriavidus basilensis FW507-4G11

Annotation: CoA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 transmembrane" amino acids 310 to 332 (23 residues), see Phobius details amino acids 609 to 629 (21 residues), see Phobius details PF02629: CoA_binding" amino acids 9 to 101 (93 residues), 38.6 bits, see alignment E=3.7e-13 PF13380: CoA_binding_2" amino acids 11 to 137 (127 residues), 81.9 bits, see alignment E=1.3e-26 PF13607: Succ_CoA_lig" amino acids 157 to 293 (137 residues), 158.8 bits, see alignment E=1.8e-50 PF13549: ATP-grasp_5" amino acids 495 to 710 (216 residues), 213.5 bits, see alignment E=6.2e-67 PF02786: CPSase_L_D2" amino acids 504 to 613 (110 residues), 21.6 bits, see alignment E=3.6e-08

Best Hits

KEGG orthology group: None (inferred from 74% identity to reu:Reut_B3702)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQS6 at UniProt or InterPro

Protein Sequence (718 amino acids)

>RR42_RS36295 CoA-binding protein (Cupriavidus basilensis FW507-4G11)
MPDLDFLLKPRSVAVIGASTQPEKVGGMPIRLLRELGYAGRIFPVHPTASEIQGLPAYAT
LAAIGQPVDLAIVAVPAVATESVMAQLARNGTRAAIFFTSGFAEVGDEGLAMQVALAESA
RRHGVVLLGPNCLGVMNLRERMFATFSPIPLTGVPPAGDVGLVSQSGAFGAYAFALAREA
GLGLSHWVTTGNEAGLQVADVIEWMAQDKDTRVILAYMEGCRDGARLRQALAAARAAGKP
VVITKVGTTEAGARSAQSHTASLAGEDAVYQAVFDEYGVHRAHTIEDFFRLGYTLSRGRR
PARWHSPSGLLADAVAPVAIVTVSGGVGIMMADRAEELGMPMPPMPAAAAKALRESIPFA
STANPIDVTGQVVAQPAVLLDAMAGVATCGEYGSVVAFLAGGANAPRLWEELQRTIRALH
EDKRAAPLLLSGVVDDDKRAWLEAHGCLVFREPAHAIEAVAALARAAAWEAAASVPVAEA
AAPVGALLRDVPDDASALSEFDAMRLLADAGVPVAAHGLARDADEAVALAQRIGYPVAVK
LCSAQVLHKSDAGGVALNLTDAAAVRKAFAAMQAALARADASLPFEGALVARMVRGWGEL
MVGVRRDPVFGLVVLAGIGGTAVEIFRQMAFGLAPLSPERARAMLEHSRAAVLFAGHRGN
PVLPLAQAADLLVRVSKVAAALGPRLDTLEINPFIIGADGAVAADAVITLLPAGGSRA