Protein Info for RR42_RS36075 in Cupriavidus basilensis FW507-4G11

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF00106: adh_short" amino acids 8 to 194 (187 residues), 178.1 bits, see alignment E=2.2e-56 PF08659: KR" amino acids 10 to 169 (160 residues), 61.7 bits, see alignment E=1.3e-20 PF13561: adh_short_C2" amino acids 14 to 215 (202 residues), 121.8 bits, see alignment E=5.4e-39

Best Hits

KEGG orthology group: None (inferred from 77% identity to pmy:Pmen_4578)

MetaCyc: 41% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YS71 at UniProt or InterPro

Protein Sequence (247 amino acids)

>RR42_RS36075 oxidoreductase (Cupriavidus basilensis FW507-4G11)
MSTNIASKVVVITGASSGLGEATARHLGAAGASLVLAARRGDRLATLAAEIRAKGGKVEV
VVADVSRRADVEALVQKAVASFGRIDVMINNAGLMAIAPMSEAKVEEWERMIDINIKGVL
YGIAAALPVFQKQGTGHFINIASVAGVKVFSPGGTVYSGTKFAVRAISEGLRHETGGAIR
TTVISPGAVDSELKLGSSHAQSAKVVGEFYQQAIPADSVARAIAYAIEQPADVDINEIVL
RPTVQEF