Protein Info for RR42_RS36000 in Cupriavidus basilensis FW507-4G11

Annotation: pilus assembly protein CpaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR03177: Flp pilus assembly protein CpaB" amino acids 12 to 271 (260 residues), 162.5 bits, see alignment E=5.9e-52 PF16976: RcpC" amino acids 107 to 221 (115 residues), 102.9 bits, see alignment E=5e-34

Best Hits

KEGG orthology group: K02279, pilus assembly protein CpaB (inferred from 63% identity to reu:Reut_B5408)

Predicted SEED Role

"Flp pilus assembly protein RcpC/CpaB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG09 at UniProt or InterPro

Protein Sequence (323 amino acids)

>RR42_RS36000 pilus assembly protein CpaB (Cupriavidus basilensis FW507-4G11)
MTSKQIRVLAIALLVLAALLALLAWRVARTPAKPAEPVAASAQSYPVVVTVKPIEAGKPV
PVDALKVEQLPINPAGAYTEVARVAGQVPLVGIGANVPVLESQLLAGLATQVKEGERAVA
VAVDEVIGVGNQVQPGDFVDVFAVFRRDGQEITGSQARMLLARLRVLAYGAGTVNEAAKP
PPEQMMARREGAKTAVLAVPVANVGKLAIAQQTGRLLLALRNPDDPDVPTEGLFEDPAPV
LQAKTQAKGGVPAAALAPSDRAMAGVALTGIAGGARGEALPVKAAPSPVPAPAAIAQRPH
GAIASSVAQNSVEMIRGGKREIE