Protein Info for RR42_RS35975 in Cupriavidus basilensis FW507-4G11

Annotation: pilus assembly protein TadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 300 to 327 (28 residues), see Phobius details PF00482: T2SSF" amino acids 192 to 317 (126 residues), 49.5 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 67% identity to reh:H16_B0189)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG05 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RR42_RS35975 pilus assembly protein TadC (Cupriavidus basilensis FW507-4G11)
MDSTTLISLSLCAAAIGLAALALPLVGQWRQRRRAERTIDAALSRQAAAAAAVPDAPATA
PATAPANAAVAQGAGARIGARLGSQLGKRFDQRWLESPLGKAVVTAEEQRLLEQCGFYGD
KARAIFGGLRLSLPAALAAGVFAWRLPTSVMGAAMWAFVTFAVFFLAPKWALRRRASSRM
LRLEDELPVLVDMLRLLQGVGLSIDQSLQVIVAEFGSMLRVLGPELMRANQQFASGRSRD
QTLQRIGKLFDSEDLKNLITMLSQVDRFGGAVQEPLRQFGLRLQESRKARMKEQVGKLTV
KMTAVMVVTMLPVLLIITAGPGFLGVIRMLAHMSGGSK