Protein Info for RR42_RS35860 in Cupriavidus basilensis FW507-4G11

Annotation: chemotaxis protein CheX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 234 to 389 (156 residues), 44 bits, see alignment E=9.8e-16 PF00990: GGDEF" amino acids 234 to 385 (152 residues), 72.2 bits, see alignment E=4.6e-24 PF00563: EAL" amino acids 406 to 640 (235 residues), 249.5 bits, see alignment E=3.1e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFY8 at UniProt or InterPro

Protein Sequence (653 amino acids)

>RR42_RS35860 chemotaxis protein CheX (Cupriavidus basilensis FW507-4G11)
MSASLLLLVALSSLAVWLGIRAAKPDREQPSGPARSLQWAVLLLSPASVGLPLWVALGSG
SLRVTHGVSRTAAALVATAALTLAIPWLRRNVPLRGAALVMTLAGAGVVVAAGMRLSTLC
GEAPHPSALCLDPGRFMPPAWVAAGALFLLPLGFFALRRANLPGWRLASSGNFSSPRSPA
LDEMFEDHPPGTGGIAGSGGPTVPMRRRGRIPGRLTVRATARGHGTVGEYSVSTDLPDRA
GFARWLDQSIAQARLAETSCAVLLVHIADFREVDEVFEVRADDILAQDAGALAQAALEPH
DFLARLARDEFAVGVPEMVHQNRANELGARLLGSLAEFVAARGLQMQIGVNIGIAIYPRD
AQTSEALMQAARVSLSEARESGSNQVRVFNSAAGERARRMRVIRRDLWLAIQDDGLALQY
QPKFDVRQRIVIGAEALCRWRHPTLGQVNPAEFITVAEQSGQIDKLDDWVIATVCRQIRQ
WQDDGIPVVPVAINVSGLRFASRDFPQYLLEQIHQHDIPPSAVTLEITETAAMKDIAQSL
ETLLELQALGIHVALDDFGSGYSSLGYLKRLRVGTLKIDRTLIGGLDVDAQGRAIVGSMV
ALAHELKMRVVAEGVESHSQLDILAGMGCDEAQGYLLSHPLDPATFANLLSGP