Protein Info for RR42_RS35610 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome C biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details PF13386: DsbD_2" amino acids 11 to 206 (196 residues), 37.6 bits, see alignment E=2.2e-13 PF02683: DsbD" amino acids 12 to 216 (205 residues), 55.7 bits, see alignment E=6.6e-19

Best Hits

KEGG orthology group: None (inferred from 79% identity to rpf:Rpic12D_3524)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcdA (DsbD analog)" in subsystem Biogenesis of c-type cytochromes or Experimental tye or Periplasmic disulfide interchange or Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRZ6 at UniProt or InterPro

Protein Sequence (242 amino acids)

>RR42_RS35610 cytochrome C biogenesis protein (Cupriavidus basilensis FW507-4G11)
MELGFGSYGFGFLAGLLSTLSPCVLPLVPVLLGSATSMHPRAPLALAGGLAISYATIGTL
LAWAGTALSIDTGVFRLLGATTLALLGVVLLSGSLQQRFATATSGLSAAGSSLISLAQPD
GLWGQFAIGLMLGVVWSPCVGPTLGAAVVLASQGSHLPQAALLMGVFGIGAALPVVALAY
VSRGAMVKMRGNLMRAGKTGKIAMGVIMVAVAGLMLSGTDKAMEAWLVDHSPAWLTALTT
RF