Protein Info for RR42_RS35470 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 40% identical to Y4147_CUPNH: Uncharacterized protein H16_B0147 (H16_B0147) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 81% identity to reu:Reut_A1190)

Predicted SEED Role

"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

aromatic compounds degradation via β-ketoadipate (9/9 steps found)
protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
superpathway of aerobic toluene degradation (19/30 steps found)

KEGG Metabolic Maps

Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YVZ4 at UniProt or InterPro

Protein Sequence (115 amino acids)

>RR42_RS35470 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MSGIPEFKDLTKEVATQMRALRQTQPDLMAAFGQLAVAGTKEGALSKKTRELVALGIAIA
CRCDDCIGFHVQTLVKLGTTRAELEEVLGTAVYMGGGPSMMYATHALRAFEDFSV