Protein Info for RR42_RS35405 in Cupriavidus basilensis FW507-4G11

Annotation: arsenic ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 TIGR04291: arsenical pump-driving ATPase" amino acids 7 to 570 (564 residues), 784.4 bits, see alignment E=6.7e-240 PF02374: ArsA_ATPase" amino acids 8 to 291 (284 residues), 179 bits, see alignment E=7.6e-56 amino acids 328 to 467 (140 residues), 106.2 bits, see alignment E=1.1e-33 amino acids 458 to 580 (123 residues), 29 bits, see alignment E=3.5e-10 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 12 to 290 (279 residues), 227.2 bits, see alignment E=3.3e-71 PF01656: CbiA" amino acids 13 to 206 (194 residues), 34 bits, see alignment E=1.5e-11 amino acids 329 to 409 (81 residues), 34.3 bits, see alignment E=1.1e-11 PF13614: AAA_31" amino acids 14 to 157 (144 residues), 36 bits, see alignment E=3.9e-12 amino acids 330 to 373 (44 residues), 27.7 bits, see alignment 1.4e-09

Best Hits

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 82% identity to bmu:Bmul_5668)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRW6 at UniProt or InterPro

Protein Sequence (583 amino acids)

>RR42_RS35405 arsenic ABC transporter ATPase (Cupriavidus basilensis FW507-4G11)
MTLPNTATRYLFFTGKGGVGKTSLSCATGLALVEAGKNVLIVSTDPASNLDEVLGVALSQ
VPTAIPGAAGLFALNIDPEASARAYRERMVTPYRGVLPAAAIQSMEEQFSGACTVEIAAF
DEFSKLLGDPQATAEFDHVIFDTAPTGHTLRLLTLPTAWNEFIGSSTGGASCLGPLAGLE
KQKALYAATVERLSNPAETTVVLVSRPEVSSFREANRTRGELAELGVRNLTLAINGLFTT
EQTNDAIALAMSQRAREALANIPDALAGLTRTTIPFLPKGTVGLDALRLMAHPERAESAA
TSETMPQTPLPPGLASLIEEIAQGGHGVIMTMGKGGVGKTTVAAAIALSLAKRGGKVVLS
TTDPAAHVAAAMDGDVPGLTVTRIDPEHEVAQYTREVLEKAGKSLDAGGRAMLEEDLRSP
CTEEIAIFRAFARTVDEGKDGFVVLDTAPTGHTILLLDAAEAYHREVMRTQGDMPESVRQ
LLPRLRDKKYTRVLIVTLPEATPVHEAERLQGDLARAGIEPFAWVINQSLLASGTHNPLL
CQRGAYEVPFVRRVADKLATRCALIPWLAEAPVGHHGLEQVVS