Protein Info for RR42_RS35345 in Cupriavidus basilensis FW507-4G11

Annotation: polyphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03976: PPK2
  • amino acids 19 to 243 (225 residues), 305.6 bits, E=1.1e-95
• TIGR03707: polyphosphate kinase 2
  • amino acids 19 to 244 (226 residues), 351.3 bits, E=1.3e-109

Best Hits

Swiss-Prot: 47% identical to PK21A_RHIME: Polyphosphate:ADP phosphotransferase 1 (SMc02148) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 84% identity to reu:Reut_C6193)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Protein Sequence (268 amino acids)

>RR42_RS35345 polyphosphate kinase (Cupriavidus basilensis FW507-4G11)
MKKTKASNQEDDAEVSSISHGEYEEELHLLQIELVKLQRHFLCCNDRILVIFEGRDASGK
DGTIKRIVEHLSPRETRVVALGKPSDRDRGSWYFQRFAAELPAAGEFTLFNRSWYNRAGV
EHVMGFCTDAEHEEFMSSVLEFEGMLVRSGIRLIKYYLDITKPEQKKRLEDRRRDPLKQW
KISPIDEQAVSLWNKYSKARNEMFARTNAVVPWNVVSADDKRLARLNVIKDLLHRLHYAD
KDEQLIRPRRQIVFPYADEHLLSGAIAK