Protein Info for RR42_RS35235 in Cupriavidus basilensis FW507-4G11

Annotation: glutathione ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 105 (105 residues), 40.9 bits, see alignment E=2.1e-14 PF00528: BPD_transp_1" amino acids 117 to 317 (201 residues), 134.8 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 45% identical to Y1050_BRUA2: Putative peptide transport system permease protein BAB2_1050 (BAB2_1050) from Brucella abortus (strain 2308)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 89% identity to reh:H16_B0720)

MetaCyc: 37% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFN5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>RR42_RS35235 glutathione ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MSAYILRRLLALLPTLLFASLIVFVIVRMVPGDVVDLMLSQNDISADTKSREDLIRALGL
DQPMWFQYVHWIGNIVLHGDLGQSLWQGEPVLKMVLARMPATFSLGALALFVALSVALPV
GVLSAIRQDTAADYVARSFSILMLAVPSFWMGTMIMVFPSVWWGWSPEVRYVPFLEDPLQ
HISNMLVPAIILGMALSAITMRMTRTMMLEVLRQDYIRTAWAKGLNERLVILRHALRNAL
IPVVTLIGLQAPLLIGGAVVIEQIFALPGMGLLLLDAVNQRDYPVITGVFLVVGVAVMLI
NLLVDLSYGLFDPKVRHR