Protein Info for RR42_RS35135 in Cupriavidus basilensis FW507-4G11
Annotation: transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 83% identity to reh:H16_B1915)Predicted SEED Role
"Regulatory protein of benzoate catabolism" in subsystem Benzoate transport and degradation cluster
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-tryptophan biosynthesis (13/13 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of chorismate metabolism (45/59 steps found)
- chorismate biosynthesis I (7/7 steps found)
- chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.71
Use Curated BLAST to search for 2.7.1.71
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YRI6 at UniProt or InterPro
Protein Sequence (324 amino acids)
>RR42_RS35135 transcriptional regulator (Cupriavidus basilensis FW507-4G11) MSSTILHVPGLTRESADEHEADAAPGNGSAAEAGGLEKNAFLAALGERVRELRSRRGLTR KATAVAAGVSERHLANLEYGSGNASILVLLQIASALHCSLAELLGDVSTSSPEWLLIREL LEHRDEGTLRRVRIAVGEMLGTGGGNAARSPRVALIGLRGAGKSTLGGMLAEDLGFPFVE LSREIEKFAGCSISEIQGLYGMNAYRRYERRALEEAIQIYPEAVIATPGGLVSDPATFNL LLAHCTTVWLQASPEDHMNRVRAQGDFRPMAASKEAMEDLRHILAGRAAFYSKAEFSVDT SAEPLEPTFLALRERVRYALQLPL