Protein Info for RR42_RS35115 in Cupriavidus basilensis FW507-4G11

Annotation: riboflavin synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00885: DMRL_synthase" amino acids 12 to 150 (139 residues), 138.3 bits, see alignment E=8.7e-45

Best Hits

Swiss-Prot: 63% identical to RISB2_RHILO: 6,7-dimethyl-8-ribityllumazine synthase 2 (ribH2) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 66% identity to vap:Vapar_1854)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.78

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQ20 at UniProt or InterPro

Protein Sequence (156 amino acids)

>RR42_RS35115 riboflavin synthase subunit beta (Cupriavidus basilensis FW507-4G11)
MQDTAPVNPAWRFAFIHAQWHADIVHQARDAFLAEMAARGVAREAVDVIEVPGAFEIPLH
ARKLADTGRYAAIVASGFVVDGGIYRHEFVADAVIGGLMRVQLDTQVPVLSAVLTPKSFH
DHEDHRKFFSEHFVVKGREAAQACIKTVESLSKLAA