Protein Info for RR42_RS35065 in Cupriavidus basilensis FW507-4G11

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 77 to 98 (22 residues), see Phobius details PF00072: Response_reg" amino acids 5 to 119 (115 residues), 70.5 bits, see alignment E=1.3e-23 PF00196: GerE" amino acids 154 to 208 (55 residues), 39.8 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 37% identical to RCSB_SALTI: Transcriptional regulatory protein RcsB (rcsB) from Salmonella typhi

KEGG orthology group: None (inferred from 60% identity to reh:H16_B2081)

Predicted SEED Role

"FIG00976681: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRG7 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS35065 LuxR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MPLKILIADDHPAITLAVRSQLRSQTGWEVCADVHSSAELLQAVRAFRPDIVVTDYHMPC
SNASDGIRLLASLRRHFPALGVVVLTMITNPLVLRAILNAGAHGLLLKDSQLDELVTAII
RVERGLRFIGDSAARVLAQSGAHYAPGRAGALCLSVRESEVMRLYLSGNSITGIAGQLSR
SVKTISRQKNSAMRKLGASNERELFDFAAQQGLVLPNPDSPQESPPASQSDWL