Protein Info for RR42_RS35020 in Cupriavidus basilensis FW507-4G11

Annotation: rubredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 PF00301: Rubredoxin" amino acids 11 to 56 (46 residues), 81.1 bits, see alignment E=2.4e-27

Best Hits

Swiss-Prot: 62% identical to RUBR_ACIAD: Rubredoxin (rubA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 88% identity to reu:Reut_B3629)

MetaCyc: 59% identical to rubredoxin 1 (Mycobacterium tuberculosis H37Rv)
Alkane 1-monooxygenase. [EC: 1.14.15.3]

Predicted SEED Role

"Rubredoxin" in subsystem Rubrerythrin

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNF8 at UniProt or InterPro

Protein Sequence (61 amino acids)

>RR42_RS35020 rubredoxin (Cupriavidus basilensis FW507-4G11)
MQQEAVVYKTWVCLICGWVYDEEQGWPDDGIAPGTRWDDIPEDWRCPECDVGKGEFAMIE
I