Protein Info for RR42_RS34860 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 186 to 211 (26 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details PF02518: HATPase_c" amino acids 532 to 618 (87 residues), 38.6 bits, see alignment E=6.4e-14

Best Hits

KEGG orthology group: None (inferred from 66% identity to rme:Rmet_4987)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRB8 at UniProt or InterPro

Protein Sequence (629 amino acids)

>RR42_RS34860 histidine kinase (Cupriavidus basilensis FW507-4G11)
MALLPILRLVCLSALWLAMGCGVTACGAERGPSAPDPANQVQVLRQALAVVRPDGARQGQ
APQPAEVTLPHDWDRVYPGRDGMATYRLDFPYHGGGQDIPALYLARAANSFEMRLNGKLL
AASGAMDAPALYGGQRPLYIPVPEAMLQPENALTITIAARANAKAGLSRVEFGPGQLVHS
HYLGALWFRVIGPLVITALSLLLTAISLLIWWRQRDPLFGLYALAEIAWSVSVVERLLDS
APLPLHAWLVLVLASRTLFIVATARFALIIIDVRSPWPAWLVTAFLWIKLPLIVVMTFLF
NTPSLKLFDWAINMLLACGIATALAWAALRRPSRERLVLAATVALASALSTADVIRIQFS
NDYYWDTSLTKYVSQLFSLSMAWLLVDRYTRTTSTLAELNRNLDRKVAQKEEELHLLYAH
SREIEREQATLRERGRIMRDMHDGLGSTLVGALSLLRSGHGSPMVLQQHLQQALDALKLS
VDAMQDTGGDLAVVLGNLRYRLRARLEAARLRVDWQVERLPPVAGLTPQIVRELQYLLLE
AFSNVMQHAGGATVQVVARSVAGAEAILIEIRDDGRGFDAQSGAQGHGLANMRSRAAAIG
GELSIASSDRGTTVSLLLYPARWAEGEAA