Protein Info for RR42_RS34565 in Cupriavidus basilensis FW507-4G11

Annotation: GDP-mannose mannosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 17 to 142 (126 residues), 71.9 bits, E=2.7e-24

Best Hits

KEGG orthology group: K03207, colanic acid biosynthesis protein WcaH [EC: 3.6.1.-] (inferred from 66% identity to bpy:Bphyt_0813)

Predicted SEED Role

"GDP-mannose mannosyl hydrolase (EC 3.6.1.-)" in subsystem Colanic acid biosynthesis or Mannose Metabolism or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See A0A0C4YFA1 at UniProt or InterPro

Protein Sequence (150 amino acids)

>RR42_RS34565 GDP-mannose mannosyl hydrolase (Cupriavidus basilensis FW507-4G11)
MLTKSDFLRVVASTPLVSIDLLVTDTQGRVLLGRRRNRPAQGSWFVPGGRIRKDEGLDAA
FRRIVADELGLTGVERGDAAPRGVFEHHYPDNFAAEPGISTHYVVLAYAWTMPGAAPLGQ
PDQHSEYCWMTPAELLAHAEVHENTRAYFR