Protein Info for RR42_RS34440 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 332 to 356 (25 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 60% identity to bug:BC1001_0531)

Predicted SEED Role

"FIG00456118: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YN18 at UniProt or InterPro

Protein Sequence (428 amino acids)

>RR42_RS34440 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MRNRFATLWIWLMLCPLAVDFKSVDENGSRLTQILLTLPVIAAGIALALIAPRFVTRTRL
SSVVMAALLLTVPGSIVPQWVQGNDVGNYLRVLLPFMLFLIGYLAARHPWPQARLRQFES
AMFAAMVTSLLFSFAYGMAVGGGLETVRFRIVSVVFLATQGVLLHEFVIARRVTRFTVLL
FIGTVAIEMLSVTRSLLVGTALLFCFATWLSAASLRHLLKAVLRAVVITTVLVGGTALIG
SELFPSVAAHWTQRIAAGKATASGIDPTTATRLAELKDQYDQVTSNTTSLMVGKGYGHFY
RYSPAYLKALSGQMSEKEFYAINEWTAGHNFWVYQLFAGGLLFGIAFPAIVLFSLYRGSV
AYRHWRRVAPNAPNLAVMGRALLVLAALPATSIGGNPLGPRFSGVVYGVALGLLVATHAQ
LARSTAAK