Protein Info for RR42_RS34295 in Cupriavidus basilensis FW507-4G11

Annotation: arsenic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 56 to 58 (3 residues), see Phobius details amino acids 61 to 77 (17 residues), see Phobius details amino acids 103 to 132 (30 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details PF02040: ArsB" amino acids 20 to 408 (389 residues), 120.5 bits, see alignment E=1.8e-38 PF03600: CitMHS" amino acids 23 to 355 (333 residues), 149.1 bits, see alignment E=2.8e-47 PF00939: Na_sulph_symp" amino acids 35 to 202 (168 residues), 38.1 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: K03893, arsenical pump membrane protein (inferred from 76% identity to reu:Reut_B3672)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YF57 at UniProt or InterPro

Protein Sequence (419 amino acids)

>RR42_RS34295 arsenic transporter (Cupriavidus basilensis FW507-4G11)
MQFSQYSGPLIWAVAAATTFGVITRPFRLPEAFWAVAGALLLCVTGLLAVPDAMAAVARG
YDVYLFLGGMMLVSELARKTGLFDHVAAVAVRQAGGSARRLFLLVYGFGTLVTVFMSNDA
TAVVLTPAVLAAARAAKVKHPLPYLYSCAFIANAASFVLPISNPANLVIFGAHMPSLMGW
LARFTLPSLVAIVATFAALYWTQRDALRERIATDVPVPPLSLEARLTAAGIVVMGLVLLT
ASLLGADLGWPTCLAGVATLVLVCACRPGLCLPALREISWGVLPLVAGLFVLVAGLEQTG
LIGKLAHVVQALSQQSPTAGVWVTGGTVALVSNVVNNLPAGLFASSALAASHASTQVTDA
VLIGIDLGPNLSVTGSLATLLWLTALRREGHHIGALQFLRIGALVMPLALVPALATLLL