Protein Info for RR42_RS34260 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): Alcohol dehydrogenase (EC 1.1.1.1)
Rationale: Specifically important for utilizing Ethanol. Automated validation from mutant phenotype: the predicted function (ALCOHOL-DEHYDROG-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 30 to 134 (105 residues), 113.3 bits, E=5.1e-37
• PF00107: ADH_zinc_N
  • amino acids 179 to 304 (126 residues), 105.9 bits, E=1.6e-34

Best Hits

Swiss-Prot: 65% identical to ADHA_RHIME: Alcohol dehydrogenase (adhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K13953, alcohol dehydrogenase, propanol-preferring [EC: 1.1.1.1] (inferred from 91% identity to reu:Reut_B3677)

MetaCyc: 91% identical to furfuryl alcohol dehydrogenase (Cupriavidus pinatubonensis JMP134)
Alcohol dehydrogenase. [EC: 1.1.1.1]; 1.1.1.- [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• heterolactic fermentation (15/18 steps found)
• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• mixed acid fermentation (12/16 steps found)
• (S)-propane-1,2-diol degradation (4/5 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• salidroside biosynthesis (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol III (2/3 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• phenylethanol biosynthesis (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-methionine degradation III (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

See A0A0C4YQX0 at UniProt or InterPro

Protein Sequence (342 amino acids)

>RR42_RS34260 Alcohol dehydrogenase (EC 1.1.1.1) (Cupriavidus basilensis FW507-4G11)
MTAMMKAAVVREFGAPLTIDEVPVPQPGRGQIQVKIEASGVCHTDLHAAEGDWPVKPTLP
FIPGHEGVGYVSAVGAGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSV
NGGYGEYVVADPNYVGLLPDSVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGL
GHVAVQYARAMGLRVAAVDIDDKKLELARKLGAEVTVNARTTDPVAFLQKEIGGAHGALV
TAVSPKAFGQAIGMVRRGGTIALNGLPPGDFPTPIFDVVLKGITIRGSIVGTRSDLQESL
DFAAHGAVKATVSTAPLEKINEIFTRMRAGDIEGRVVMDFAA