Protein Info for RR42_RS34240 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): putative efflux pump, required for thallium (I) resistance
Rationale: PFam PF02694.11 (UPF0060). conserved specific phenotype of UPF0060
Original annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details PF02694: UPF0060" amino acids 2 to 105 (104 residues), 120.9 bits, see alignment E=1.4e-39

Best Hits

Swiss-Prot: 85% identical to Y3679_CUPNJ: UPF0060 membrane protein Reut_B3679 (Reut_B3679) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09771, hypothetical protein (inferred from 85% identity to reu:Reut_B3679)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YMX9 at UniProt or InterPro

Protein Sequence (105 amino acids)

>RR42_RS34240 putative efflux pump, required for thallium (I) resistance (Cupriavidus basilensis FW507-4G11)
MKTFALYLITACAEILGCYFPYLWLRQGASAWLLVPGALSLALFAWLLSLHPDASGRVYA
AYGGIYIAVAILWLWLVDGVKPSHWDLAGVAVAIAGMAMIVFQPR