Protein Info for RR42_RS33780 in Cupriavidus basilensis FW507-4G11

Annotation: GABA permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 207 to 232 (26 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 408 to 431 (24 residues), see Phobius details amino acids 437 to 454 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 21 to 434 (414 residues), 125.4 bits, see alignment E=4.4e-40 PF00324: AA_permease" amino acids 21 to 435 (415 residues), 390.4 bits, see alignment E=1.7e-120 PF03845: Spore_permease" amino acids 21 to 289 (269 residues), 32.5 bits, see alignment E=6.4e-12

Best Hits

Swiss-Prot: 53% identical to GABP_BACSU: GABA permease (gabP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 85% identity to reu:Reut_B3753)

MetaCyc: 46% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEX6 at UniProt or InterPro

Protein Sequence (474 amino acids)

>RR42_RS33780 GABA permease (Cupriavidus basilensis FW507-4G11)
MIHHQQQQQSSGLKHGLKQRHMTMIALGGVIGAGLFVGSGVVIKSAGPAAVISFLITGLL
VVLVMRMLGEMACALPTVGSFYEYAREAWSDRPAMGELAGFLTGWMYWYFWVIVVALEAV
AGASLVQFWLPGVPAWSISLVLLVMLTLTNLISVKSFGEFEFWFASIKVAAIVVFLFLAG
LFVLGMWPGATASVAHLTVHGGFAPNGIMPVLTGAVAATGFYFGAEIVTIAAAETAEPQK
AVARATSSVITRVLVFYVGSVLLVVCLVPWNSAGIATPYVSALNAMRIPAAAQIMNAVVL
TAVLSALNSGLYASSRMLFALTKRGDAPKALARLSRNGVPVRAILFATLFGYGAVVMSYV
SPDKVFAFLVNSYGTVAIFVYILIAISQLRLRARLEREAPHRLKVRMWAFPYLTWVAIAG
MVGIVVAMAFIPDQRTPLLLGVASLGILVVAYAVRQQLRKHAAAAPLGEVRRAD