Protein Info for RR42_RS33720 in Cupriavidus basilensis FW507-4G11

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details PF00456: Transketolase_N" amino acids 29 to 267 (239 residues), 129.1 bits, see alignment E=2e-41 PF00676: E1_dh" amino acids 121 to 231 (111 residues), 31.3 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 70% identical to Y4MO_SINFN: Putative uncharacterized transketolase family protein y4mO (NGR_a02440) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 90% identity to reu:Reut_B4777)

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQJ9 at UniProt or InterPro

Protein Sequence (281 amino acids)

>RR42_RS33720 transketolase (Cupriavidus basilensis FW507-4G11)
MNSSSSDALVPLPERAYRIRRNALLMGEVQGQGYIGQALDIADVLAVAYFGAMKYRPEDP
GWEGRDRFLLSNGHYAIALYAALFEAGILPAGELETYGSDDSRLPMSGMASYTPGMEMSG
GSLGQGLTIAVGRCLGLKRKGSDAFVYTLFSDGELDEGAIWEGIMSASHWKLDNLIAMVD
VNNQQADGPSTQIMAFEPLVEKLEAFGWFTQRVDGNDIAAVAAAFDAARSHPGAQPRIIV
CGTRMGCGVPFLEQREKNHFIRVDAHEWQLALEALESGRQA