Protein Info for RR42_RS33670 in Cupriavidus basilensis FW507-4G11

Annotation: taurine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 115 to 281 (167 residues), 96.8 bits, see alignment E=6.6e-32

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 87% identity to cti:RALTA_B0793)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQI8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>RR42_RS33670 taurine ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MSASAQRLEPAPGTAAVAAKPPARRMKAVSGYRLPGEGSSSRISTITVVSLLALWWIGSH
LRWLPPLFLPTPEAIINAFIDAWNGNVQGGLPLTEHFRASMVRVFGAFALATVTAVPIGV
MMGVSRIARGVFDPPIEFYRPLPPLAYLPLIVIWFGIDETSKILLIFLACFAPLAMSAQA
GVRSVTIEQINAAYSMGANRWQVIRHVVIPAALPDILTGMRIAIGFGWTTLVAAEMVAAT
SGLGQMVLNASNFLRTDVVIMGIGLIGLIAYTFDLLMRKTEKWLVPWKGRM