Protein Info for RR42_RS33510 in Cupriavidus basilensis FW507-4G11

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 372 (340 residues), 97.7 bits, see alignment E=3.5e-32

Best Hits

KEGG orthology group: None (inferred from 77% identity to cti:RALTA_A1707)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YMK1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>RR42_RS33510 permease (Cupriavidus basilensis FW507-4G11)
MNNPASAAHHRELTSAADAETLARRARRGIVLLTFAFALSQFYRSCLAVMAPELQHDFGL
SAAGFGTLSSSFFLAFAVAQIPVGIAFDRYGVGKPTSLLLAIGAVSAVVFSLAPNGTVAM
LAQAGLGLACAPVFMGLLHFASEQLSEKNYTRVVSQSNATGMIGALCATAPLGWAMHLLG
WRVAMSVAALCMVVACYGVWRFVRDDGHAEARGVPLGSMLSQSAKLLAIVPLWTLIPMCV
AMAAGTAFRNAWSGPYLASVYGLNSGSRGIALTLLSVSGFLTAFFLPVLVRRSSLKTTIA
GWSCFAMSGAIALSLWPTHGIVSGVALMALLSTIGMLHPLVMAQGRGLVPPSSRGRGLGV
LNTFVFLGSALASWGFGMIASMGDARHWPVAKTYSTIFLTAAVVVALAVAPYFFSPSSPS
VIKR