Protein Info for RR42_RS33495 in Cupriavidus basilensis FW507-4G11

Updated annotation (from data): L-phenylalanine:H+ symporter AroP
Rationale: Specifically important for utliization of phenylalanine as the nitrogen source.
Original annotation: aromatic amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 430 to 448 (19 residues), see Phobius details PF00324: AA_permease" amino acids 21 to 456 (436 residues), 420.9 bits, see alignment E=6.4e-130 PF13520: AA_permease_2" amino acids 25 to 432 (408 residues), 129.3 bits, see alignment E=2e-41

Best Hits

Swiss-Prot: 71% identical to AROP_SHIFL: Aromatic amino acid transport protein AroP (aroP) from Shigella flexneri

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 88% identity to reu:Reut_B4502)

MetaCyc: 71% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YP23 at UniProt or InterPro

Protein Sequence (465 amino acids)

>RR42_RS33495 L-phenylalanine:H+ symporter AroP (Cupriavidus basilensis FW507-4G11)
MVPNASDNTDATLKRGLKNRHIQLIALGGAIGTGLFLGIAQTIKMAGPSVLLGYAVAGII
AFFIMRQLGEMVVDEPVAGSFSHFANKYCGSFAGFMSGWNYWVLYILVSMAELSAVGIYV
QYWWPHIPTWASALGFFLLINAINLTSVKSFGEMEFWFSIVKVLAIVGMIVFGGYLLASG
TAGPQASVSNLWQHGGFFPNGISGLVMAMAVIMFSFGGLELVGITAAEADEPEKTIPKAT
NQVIYRILIFYVGALGVLLSLYPWEKVVTGGSPFVLIFHAMNSDIVATVLNAVVLTAALS
VYNSGVYCNSRMLFGLAKQGNAPKALLKVNKRGIPLAALGVSALATAACVVINYFMPGEA
FELLMGLVVSALIINWAMISIIHLKFRRDKRAAGQETRFKSLGYPLTNYVCLAFLAGILY
VMYLTPGLRISVYLIPAWLAVLGLSYRLRQKQKRAEPALPERVSA