Protein Info for RR42_RS33360 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 11 to 85 (75 residues), 75.9 bits, see alignment E=9.1e-26 amino acids 98 to 168 (71 residues), 74.7 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: None (inferred from 65% identity to bpy:Bphyt_1759)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YMH7 at UniProt or InterPro

Protein Sequence (208 amino acids)

>RR42_RS33360 membrane protein (Cupriavidus basilensis FW507-4G11)
MKTRAEVVVLAADLAGTTVFAVEGAIIGMRHGLDLLGVLVVALVTAVGGGIIRDLLIGAA
PPNAIRDWRYPALASLAGTAAFVFHAAAQGFTGPLIIALDAAGLALFAVAGVQKATNYGV
RPFVATLMGTLTGVGGGVVRDMLLAQVPTVLSADIYATAAWLGSAVLVSARALRLPPAVA
ALAGGASCFALRLLAVQHDWHLPKVPVW