Protein Info for RR42_RS33280 in Cupriavidus basilensis FW507-4G11

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 206 to 366 (161 residues), 144.8 bits, see alignment E=9.9e-47 PF00990: GGDEF" amino acids 211 to 363 (153 residues), 130.2 bits, see alignment E=3.1e-42

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YUD5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>RR42_RS33280 diguanylate cyclase (Cupriavidus basilensis FW507-4G11)
MSALMSVVLLSAYYSFPRSIKGIGRWVSGSLLLIVTPVLFWLRDIAPDWLSIVVANCLVM
AAMALWMLAVQAFYGRPQTWRCAAALTVLGTLLLAWYAFGQPNYVARVTIATFVVGIFYC
VQCVVIVRYGERHFSTYFFGTLMIAQTLVVLLRFGTSLFAGMTGQSFFAPGDAIQIIYLS
SNTLMDLALSAAFMLVITRRLHVELDVLSRTDPLTLLLNRRALYAAGQEALEGMAEDGAE
MALLLIDLDHFKRINDSMGHAEGDRVLTAFSSMLRRELPPGAYPGRFGGEEFLVLLPRTG
MTGALALAERLRATSSRFFGERVADLTISIGVACLEKSETRLDDAIGRADLALYRAKSAG
RNRVEAVMQAA