Protein Info for RR42_RS33260 in Cupriavidus basilensis FW507-4G11

Annotation: multidrug MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02563: Poly_export" amino acids 79 to 175 (97 residues), 76 bits, see alignment E=2.1e-25 PF10531: SLBB" amino acids 182 to 235 (54 residues), 24.9 bits, see alignment 1.5e-09 amino acids 267 to 319 (53 residues), 30.3 bits, see alignment 3e-11

Best Hits

Swiss-Prot: 66% identical to EPSA_RALSL: EPS I polysaccharide export outer membrane protein EpsA (epsA) from Ralstonia solanacearum

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 83% identity to cti:RALTA_A1640)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YUD0 at UniProt or InterPro

Protein Sequence (379 amino acids)

>RR42_RS33260 multidrug MFS transporter (Cupriavidus basilensis FW507-4G11)
MFKLSSLLSFRRALLLLGTVPLLASCALAPGMRFDPQRPLDPEDPESVPKVTQITPALVR
AMKASSKPANDGVQDLFGTAQAYTVGVGDILSIVVWDHPELVFPTQTYTIGTAYDIPALG
GAANVPGYVVSPAGTIQFPYAGVVTVLGKTPDEIRGDLSKQLKSVVNMPQITVRVLAFRS
RRVYLDGEVKVPGPQNIDDVPMTLVEALNRAGGINVLTGDNSRIRVARDGKNYVVDLPAL
LRKGIDPARVMLRNGDIVRVEQREDSKVFVTGEVVRPSVVLPRNGRLTLNEAIGEAGGVN
PVSADAKELYVIRKSEDGEAEIFHLDGKSPVSLALAESFELKPKDVVYVDAAGVVRWSRV
INQLLPSGNFFTSTANTLK