Protein Info for RR42_RS33195 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-sugar lipid carrier transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 15 to 462 (448 residues), 523.6 bits, see alignment E=5.9e-161 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 15 to 462 (448 residues), 475.2 bits, see alignment E=2.8e-146 PF13727: CoA_binding_3" amino acids 60 to 236 (177 residues), 133.3 bits, see alignment E=1e-42 PF02397: Bac_transf" amino acids 272 to 454 (183 residues), 226.9 bits, see alignment E=1.3e-71

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 76% identity to cti:RALTA_A1632)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEN9 at UniProt or InterPro

Protein Sequence (462 amino acids)

>RR42_RS33195 UDP-sugar lipid carrier transferase (Cupriavidus basilensis FW507-4G11)
MFARHHDQLTLAARLLDVAIIWIAAYLATELRFKTDATPSAPIHQFIQYFGCTVAFIVLP
AFDLYASWRGRSAFSLFTRMLAGWTLVWLISILVCFLLHQADSLSRLWATYWYFGSIIGL
LALHIASRAVLSLVRGTGVNTKHVLIVGYGRTGQEMYQRATANPRTGYKVWGIYASADEA
TPAGVLRVEDSAKIAEFSRLHDIDEVWITLPMSATRQMQSIAYSLRNDFIDIKWMPSLLD
FDLLNHKVGDFLGMPAVELNRPPSLGVRGAVKAAFDRSFAALVLAALSPLFLVIAVLIKR
SSPGPVFFKQERLGLDGRVIHVYKFRSMKPHAEHGVVTQATKGDNRITPIGALLRRTSLD
ELPQFINVLRGEMSVVGPRPHAMAHNNIYKEQLDLYMLRHRVKPGITGWAQINGYRGETD
TLDKMAKRVEHDIFYIRNWSFWMDLRIIFWTAFKGWTGQNAY