Protein Info for RR42_RS32740 in Cupriavidus basilensis FW507-4G11

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 7 to 256 (250 residues), 142.9 bits, E=1.2e-45
• PF16113: ECH_2
  • amino acids 11 to 256 (246 residues), 123.4 bits, E=1.5e-39

Best Hits

KEGG orthology group: K13779, isohexenylglutaconyl-CoA hydratase [EC: 4.2.1.57] (inferred from 77% identity to reu:Reut_B4461)

MetaCyc: 44% identical to isohexenyl-glutaconyl-CoA hydratase (Pseudomonas aeruginosa PAO1)
Isohexenylglutaconyl-CoA hydratase. [EC: 4.2.1.57]

Predicted SEED Role

"Isohexenylglutaconyl-CoA hydratase"

MetaCyc Pathways

• cis-geranyl-CoA degradation (4/9 steps found)

KEGG Metabolic Maps

• Geraniol degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.57

Sequence Analysis Tools

See A0A0C4YNJ7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>RR42_RS32740 enoyl-CoA hydratase (Cupriavidus basilensis FW507-4G11)
MIVRDVQGVLFVTLNVPATRNALAPEVVAALARAVERAETDTTVRALVLRGAGGVFCAGG
NVGNFKARLDAGEAPQDPVASRNREFGYFMQRLAALPVPVVAAVEGAAMGGGMGLSCAAD
IVLATRDARFALSETSLGIIAAQIAPFVVARIGAAATRRLGLSGERVNGDSALALGLADA
LADDSAALDALLAEWLTRICRCGPQANRAFKPLVARTGQVAQGALLDEASHLFAQCMRSE
GAEGIQAFRDKRDAAWVVRFDAAAVRAAQATQG