Protein Info for RR42_RS32715 in Cupriavidus basilensis FW507-4G11

Annotation: peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00578: AhpC-TSA" amino acids 5 to 142 (138 residues), 111.1 bits, see alignment E=5.4e-36 PF08534: Redoxin" amino acids 6 to 154 (149 residues), 43.6 bits, see alignment E=4e-15 PF10417: 1-cysPrx_C" amino acids 163 to 202 (40 residues), 52.9 bits, see alignment 4e-18

Best Hits

Swiss-Prot: 55% identical to PRDXL_DICDI: 1-Cys peroxiredoxin (DDB_G0282517) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 89% identity to rme:Rmet_4131)

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNJ0 at UniProt or InterPro

Protein Sequence (217 amino acids)

>RR42_RS32715 peroxidase (Cupriavidus basilensis FW507-4G11)
MSIRIGDEAPDFTADTTEGKISFHEWIGDKWAILFSHPKDFTPVCTTELGYMARLKPEFD
RRNTKIIGLSVDPVADHQKWVKDIEETQGHAVNYPMIGDVDLTVAKLYDMIHPNASGGPR
TAVDNATVRSVFLIGPDKKVKAMLVYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWKP
GEDVIIPTSVSDDDAKKKYPQGFKTLKPYLRVVSQPK