Protein Info for RR42_RS32695 in Cupriavidus basilensis FW507-4G11

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 PF06505: XylR_N" amino acids 19 to 118 (100 residues), 128.9 bits, see alignment E=2e-41 PF02830: V4R" amino acids 130 to 191 (62 residues), 44.8 bits, see alignment E=3.5e-15 PF00158: Sigma54_activat" amino acids 237 to 403 (167 residues), 235.1 bits, see alignment E=1.3e-73 PF14532: Sigma54_activ_2" amino acids 239 to 408 (170 residues), 69.4 bits, see alignment E=1.3e-22 PF07728: AAA_5" amino acids 261 to 378 (118 residues), 28.6 bits, see alignment E=4.6e-10 PF01078: Mg_chelatase" amino acids 316 to 379 (64 residues), 24.2 bits, see alignment E=7.1e-09 PF02954: HTH_8" amino acids 523 to 561 (39 residues), 52 bits, see alignment 1.6e-17

Best Hits

KEGG orthology group: K01529, [EC: 3.6.1.-] (inferred from 90% identity to reh:H16_B0538)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YTZ5 at UniProt or InterPro

Protein Sequence (571 amino acids)

>RR42_RS32695 Fis family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MSSSTDKFSATMRDGLAHLARRLRFAMEEGSIWLDEQRMILIHTAALGALRKELVDTLGM
ERARGLFMRMGFHSGMRDAELAKKLRPGDSDFGLLEIGPCLHTIEGVVRVTPVKVDIDIA
AGIYDGEFLWEDSFEGDVHRQLFGIVDAPACWMQIGYATGYTSALMGRTILYREVECIAC
GFDHCRIVGKPLEAWEDGAEVLALYQPDPVIETILELQSEVEHLRALQRSPGKPADLVGS
SPEFRAAWGLLQRAAGSSVTVLLLGETGVGKERFAQALHGVSARADKPFVAVNCAAIPDE
LIEAELFGVEKGAFTGAHQSRPGRFERAHGGTLFLDELGELSASAQSKLLRVLQEGEVER
VGGSEPRKVDVRLVAATNVDLAEAVKQGTFRKDLYYRLNVYPVTIPPLRERLDDIRLLVE
RFVARYGARHGKKIVGITDRALAELRRYDWPGNVRELENVIERGVILASNGGQICADHLF
LPTSAPPGMDTAPRLGVKGTLPELREAAVHGLLDHMAEQQLALGDVETVLMEAAMQRANG
NMSQAARLLGITRPQLAYRWKTRGMRGQGAG