Protein Info for RR42_RS32625 in Cupriavidus basilensis FW507-4G11
Annotation: 4-hyroxy-2-oxovalerate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to HOA2_CUPNH: 4-hydroxy-2-oxovalerate aldolase 2 (H16_B0552) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)
KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 91% identity to reh:H16_B0552)MetaCyc: 84% identical to 4-hydroxy-2-oxovalerate aldolase (Pseudomonas putida F1)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]
Predicted SEED Role
"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)
MetaCyc Pathways
- L-tryptophan degradation IX (11/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (11/12 steps found)
- mandelate degradation to acetyl-CoA (15/18 steps found)
- meta cleavage pathway of aromatic compounds (9/10 steps found)
- catechol degradation I (meta-cleavage pathway) (5/5 steps found)
- catechol degradation II (meta-cleavage pathway) (6/7 steps found)
- toluene degradation I (aerobic) (via o-cresol) (6/7 steps found)
- 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
- toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
- toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
- superpathway of aerobic toluene degradation (19/30 steps found)
- naphthalene degradation to acetyl-CoA (6/12 steps found)
- p-cumate degradation (3/8 steps found)
- p-cymene degradation (4/11 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (21/42 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Carbazole degradation
- Ethylbenzene degradation
- Fluorene degradation
- Phenylalanine metabolism
- Styrene degradation
- Toluene and xylene degradation
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.39
Use Curated BLAST to search for 4.1.3.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YEB3 at UniProt or InterPro
Protein Sequence (349 amino acids)
>RR42_RS32625 4-hyroxy-2-oxovalerate aldolase (Cupriavidus basilensis FW507-4G11) MTQQATQKKLYISDVTLRDGSHAIRHQYSLDDVRRIAAALDAAKVDSIEVAHGDGLAGSS FNYGFGAHTDLEWIAAAAETVRHAKVATLLLPGVGTVHDLRAAFDAGARVVRVATHCTEA DVSRQHIEYARNLGMDTVGFLMMSHMTTPAALAQQARLMESYGAETVYVVDSGGALNMND VRERFRAFKDVLKPQTQTGMHAHHNLSLGVANSIVAVEEGCDRIDASLAGMGAGAGNAPL EVFIAATSRLGWNHGCDLYTLMDAADEIVRPLQDRPVRVDRETLALGYAGVYSSFLRHAE AAAGRYALKTVDILVELGQRRMVGGQEDMIVDVALDLVARRAARAEIAA