Protein Info for RR42_RS32535 in Cupriavidus basilensis FW507-4G11

Annotation: sulfonate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 129 to 157 (29 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 274 (170 residues), 90 bits, see alignment E=8.2e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 85% identity to cti:RALTA_B1997)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YLW2 at UniProt or InterPro

Protein Sequence (282 amino acids)

>RR42_RS32535 sulfonate ABC transporter (Cupriavidus basilensis FW507-4G11)
MAANDTLALPAAAGTAPAQRGKRLHGWRPTRQHAAWLLAWPVPLTLLLIWYVAARLAWIP
PQVLPAPDTVWHTLTELYQSGELQANLAVSALRVAGGFALGLAGGLALGVAMGLSPSLRD
YVYPTFKAFSQVPVLGWLPLLMLLVGIDEALKIILIAKASLVPIALNTYKGIQNVPTRYI
EVARVLRFTRWQLLSRVVFPAAAAPIWSGIRYGLTHAWLALVVVELLASSEGLGYMIVYG
RQLFQLDMVIAAVIVVGAVGFALDKVLALAERAVLRWRKPGL