Protein Info for RR42_RS32490 in Cupriavidus basilensis FW507-4G11

Annotation: 3-keto-5-aminohexanoate cleavage protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF05853: BKACE" amino acids 4 to 273 (270 residues), 314.5 bits, see alignment E=3.1e-98

Best Hits

Swiss-Prot: 39% identical to KCE_CLOAI: 3-keto-5-aminohexanoate cleavage enzyme (kce) from Cloacimonas acidaminovorans (strain Evry)

KEGG orthology group: None (inferred from 81% identity to reu:Reut_B5036)

Predicted SEED Role

"FIG00978204: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPS1 at UniProt or InterPro

Protein Sequence (274 amino acids)

>RR42_RS32490 3-keto-5-aminohexanoate cleavage protein (Cupriavidus basilensis FW507-4G11)
MQDPCIISVAITGSVPRKKDNPAIPISVAEQIESTHQSFEAGATLVHLHVRDDAGNSSSD
PVRFAELQEGIRKHCPGMIVQFSTGGRGRAMEQRGAMLDLRPDMASLATGSVNFPTTVYE
NPPDFVRALAKAMRDYHIKPEIEIFDLAMLYNTADLVKEGLLLPPVHVQFVFGIKNALPA
RKDILEFQVAQLGKVLPGATWTAAGIGRHQLEVNHWTLQLGGHCRTGLEDNVRWDKDTLA
ASNAQLVGRVAELCAQYGRAVATPQEARRLLGLA