Protein Info for RR42_RS32480 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF09339: HTH_IclR" amino acids 15 to 64 (50 residues), 51.8 bits, see alignment 5.6e-18 PF01614: IclR" amino acids 132 to 252 (121 residues), 74.3 bits, see alignment E=8.6e-25

Best Hits

Swiss-Prot: 39% identical to PCAU_ACIAD: Pca operon regulatory protein (pcaU) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 87% identity to reu:Reut_B5034)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YE90 at UniProt or InterPro

Protein Sequence (255 amino acids)

>RR42_RS32480 4-hydroxyphenylpyruvate dioxygenase (Cupriavidus basilensis FW507-4G11)
MDKEPLSRRDWIAGLEKGLAILEAFDNDHPRLTPTQAAQLTGLTRTAARRYLLTLEHLGY
TTSDGTLFSLTPRVLKVGWSYFDSARLPRTVQPFLQQITAAVGEPAYLSVLDDWELVFIC
RTGTSRVMNTGFVLGARVPAPLASSGLMMLASEPEEKVKAWLEGCVLTPYTPHTILQQDR
LMAEIRRAGAQGYALVEQQLQIGVRGVAVPLRDRHGKVIAALSVNMQIGDESAEQALERV
LRVLQDTAISIMRVL