Protein Info for RR42_RS32390 in Cupriavidus basilensis FW507-4G11

Annotation: citrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 221 to 385 (165 residues), 144.9 bits, see alignment E=9.5e-47 PF00990: GGDEF" amino acids 223 to 382 (160 residues), 124.9 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: None (inferred from 61% identity to reh:H16_B2212)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YTQ9 at UniProt or InterPro

Protein Sequence (409 amino acids)

>RR42_RS32390 citrate synthase (Cupriavidus basilensis FW507-4G11)
MQLDQQTIVVVMVVVYASTLAISAGLLGALRPSAAGRLWALGHLLVSVAGLVLAANASAR
LVYVSAGGAAAFIAGRLLIYRGVRVYYGMASWDRTLAVGVTLAALALVGAAGMAGGQARM
HVIGYGSLALVAVLTVVTLLHAYDGRRSVGTPLVVIASLIHLATHLAGFAAGLAGNVASG
PFYASSANGILLVAPLVGTLLALFGFTVMAMEQVIATNENGARLDALTRLLNRGALDKAA
ISLVAAWERHGQPLSCLVIDIDHFKQVNDRHGHHAGDTVLKLIAEAIDNSRRASDVAGRY
GGEEFCILCPHTDEGQATALASRILKKVRGIALPGESAAFASVSIGVAELRGGAAGVEGL
WRALFAAADRALYAAKEFGRDRYALASWMAPSTRPVPGDVGDSAHVPGR